PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400006324
Common NameLOC102603672
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 128aa    MW: 13994.1 Da    PI: 10.8234
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400006324genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.32.5e-194882135
                  GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                          Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  PGSC0003DMP400006324 48 CSHCGVQKTPQWRAGPMGAKTLCNACGVRFKSGRL 82
                          *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.784278IPR000679Zinc finger, GATA-type
SMARTSM004013.7E-164296IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.28E-1543106No hitNo description
Gene3DG3DSA:3.30.50.101.4E-154680IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.00E-124795No hitNo description
PfamPF003203.1E-174882IPR000679Zinc finger, GATA-type
PROSITE patternPS0034404873IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MSSSPTASWF LYPTPVHSAE SPGKPLAKKL KKKPAPHGGN GPQQPRRCSH CGVQKTPQWR  60
AGPMGAKTLC NACGVRFKSG RLLPEYRPAC SPTFSTELHS NNHRKVLEMR RKKESEETGL  120
AQPVQSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-152HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340696.13e-90PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH577e-49GATA5_ARATH; GATA transcription factor 5
TrEMBLM0ZVM04e-90M0ZVM0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000091181e-89(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.29e-48GATA transcription factor 5
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]